SULT1C4 Antikörper (Middle Region)

Produktnummer ABIN630588

Produktdetails anti-SULT1C4 Antikörper

Target: SULT1C4 (Sulfotransferase Family, Cytosolic, 1C, Member 4 (SULT1C4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULT1C4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SULT1 C4 antibody was raised against the middle region of SULT1 4

Aufreinigung: Affinity purified

Immunogen: SULT1 C4 antibody was raised using the middle region of SULT1 4 corresponding to a region with amino acids HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULT1C4 Blocking Peptide, catalog no. 33R-3718, is also available for use as a blocking control in assays to test for specificity of this SULT1C4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULT1C4

Target: SULT1C4 (Sulfotransferase Family, Cytosolic, 1C, Member 4 (SULT1C4))

Andere Bezeichnung: SULT1C4 (SULT1C4 Produkte)

Synonyme: SULT1C antikoerper, SULT1C2 antikoerper, SULT1C4 antikoerper, sult1c4 antikoerper, sulfotransferase family 1C member 4 antikoerper, sulfotransferase family, cytosolic, 1C, member 4 antikoerper, sulfotransferase 1C4 antikoerper, sulfotransferase family 1C member 4 S homeolog antikoerper, SULT1C4 antikoerper, LOC100061106 antikoerper, LOC100623441 antikoerper, sult1c4.S antikoerper

Hintergrund: SULT1C4 catalyzes the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. It may be involved in the activation of carcinogenic hyroxylamines. SULT1C4 shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.

Molekulargewicht: 35 kDa (MW of target protein)