PPP1CA Antikörper (N-Term)

Produktnummer ABIN630586

Produktdetails anti-PPP1CA Antikörper

Target: PPP1CA (Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPP1CA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PPP1 CA antibody was raised against the N terminal of PPP1 A

Aufreinigung: Affinity purified

Immunogen: PPP1 CA antibody was raised using the N terminal of PPP1 A corresponding to a region with amino acids MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPP1CA Blocking Peptide, catalog no. 33R-6411, is also available for use as a blocking control in assays to test for specificity of this PPP1CA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 A antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPP1CA

Target: PPP1CA (Protein Phosphatase 1, Catalytic Subunit, alpha Isoform (PPP1CA))

Andere Bezeichnung: PPP1CA (PPP1CA Produkte)

Synonyme: PP-1A antikoerper, PP1A antikoerper, PP1alpha antikoerper, PPP1A antikoerper, Ppp1c antikoerper, dism2 antikoerper, ppp1a antikoerper, wu:fc04c08 antikoerper, wu:fc09b07 antikoerper, wu:fc30g11 antikoerper, wu:fe05h08 antikoerper, zgc:85729 antikoerper, Ppp1ca antikoerper, fb18b03 antikoerper, fd20h04 antikoerper, wu:fb18b03 antikoerper, wu:fd20h04 antikoerper, wu:fl22a03 antikoerper, zgc:55744 antikoerper, zgc:76940 antikoerper, protein phosphatase 1 catalytic subunit alpha antikoerper, protein phosphatase 1, catalytic subunit, alpha isoform antikoerper, protein phosphatase 1, catalytic subunit, alpha isozyme L homeolog antikoerper, protein phosphatase 1, catalytic subunit, alpha isozyme antikoerper, protein phosphatase 1, catalytic subunit, alpha isozyme a antikoerper, protein phosphatase 1, catalytic subunit, alpha isozyme b antikoerper, PPP1CA antikoerper, Ppp1ca antikoerper, ppp1ca.L antikoerper, ppp1ca antikoerper, ppp1caa antikoerper, ppp1cab antikoerper

Hintergrund: PPP1CA is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: M Phase, Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Lipid Metabolism