MEK2 Antikörper (C-Term)
-
- Target Alle MEK2 (MAP2K2) Antikörper anzeigen
- MEK2 (MAP2K2) (Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MEK2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MAP2 K2 antibody was raised against the C terminal of MAP2 2
- Aufreinigung
- Affinity purified
- Immunogen
- MAP2 K2 antibody was raised using the C terminal of MAP2 2 corresponding to a region with amino acids IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
- Top Product
- Discover our top product MAP2K2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAP2K2 Blocking Peptide, catalog no. 33R-4027, is also available for use as a blocking control in assays to test for specificity of this MAP2K2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MEK2 (MAP2K2) (Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2))
- Andere Bezeichnung
- MAP2K2 (MAP2K2 Produkte)
- Synonyme
- CFC4 antikoerper, MAPKK2 antikoerper, MEK2 antikoerper, MKK2 antikoerper, PRKMK2 antikoerper, AA589381 antikoerper, MK2 antikoerper, Prkmk2 antikoerper, ATMKK2 antikoerper, F27B13.50 antikoerper, F27B13_50 antikoerper, MAP KINASE KINASE 1 antikoerper, MAP kinase kinase 2 antikoerper, MK1 antikoerper, map2k2 antikoerper, wu:fa56c06 antikoerper, zgc:123171 antikoerper, zgc:172250 antikoerper, mitogen-activated protein kinase kinase 2 antikoerper, mitogen activated protein kinase kinase 2 antikoerper, MAP kinase kinase 2 antikoerper, mitogen-activated protein kinase kinase 2a antikoerper, mitogen-activated protein kinase kinase 2b antikoerper, MAP2K2 antikoerper, Map2k2 antikoerper, MKK2 antikoerper, map2k2a antikoerper, map2k2b antikoerper
- Hintergrund
- MAP2K2 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in MAP2K2 gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- MAPK Signalweg, RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, Neurotrophin Signalübertragung, Activation of Innate immune Response, Toll-Like Receptors Cascades, Signaling of Hepatocyte Growth Factor Receptor, BCR Signaling
-