WNT16 Antikörper (Middle Region)
-
- Target Alle WNT16 Antikörper anzeigen
- WNT16 (Wingless-Type MMTV Integration Site Family, Member 16 (WNT16))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WNT16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WNT16 antibody was raised against the middle region of WNT16
- Aufreinigung
- Affinity purified
- Immunogen
- WNT16 antibody was raised using the middle region of WNT16 corresponding to a region with amino acids KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN
- Top Product
- Discover our top product WNT16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WNT16 Blocking Peptide, catalog no. 33R-4682, is also available for use as a blocking control in assays to test for specificity of this WNT16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT16 (Wingless-Type MMTV Integration Site Family, Member 16 (WNT16))
- Andere Bezeichnung
- WNT16 (WNT16 Produkte)
- Synonyme
- zgc:77293 antikoerper, E130309I19Rik antikoerper, Wnt family member 16 antikoerper, wingless-type MMTV integration site family, member 16 antikoerper, WNT16 antikoerper, wnt16 antikoerper, Wnt16 antikoerper
- Hintergrund
- WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT16 contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- WNT Signalweg
-