PSMG1 Antikörper

Produktnummer ABIN630540

Produktdetails anti-PSMG1 Antikörper

Target: PSMG1 (Proteasome (Prosome, Macropain) Assembly Chaperone 1 (PSMG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMG1 Blocking Peptide, catalog no. 33R-9697, is also available for use as a blocking control in assays to test for specificity of this PSMG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMG1

Target: PSMG1 (Proteasome (Prosome, Macropain) Assembly Chaperone 1 (PSMG1))

Andere Bezeichnung: PSMG1 (PSMG1 Produkte)

Synonyme: DSCR2 antikoerper, dscr2 antikoerper, zgc:91806 antikoerper, wu:fl12g04 antikoerper, wu:fu18c08 antikoerper, PSMG1 antikoerper, pac1 antikoerper, c21lrp antikoerper, lrpc21 antikoerper, DDBDRAFT_0206024 antikoerper, DDBDRAFT_0304546 antikoerper, DDB_0206024 antikoerper, DDB_0304546 antikoerper, C21LRP antikoerper, LRPC21 antikoerper, PAC-1 antikoerper, PAC1 antikoerper, AW552102 antikoerper, Dscr2 antikoerper, proteasome assembly chaperone 1 antikoerper, proteasome (prosome, macropain) assembly chaperone 1 antikoerper, proteasome (prosome, macropain) assembly chaperone 1 L homeolog antikoerper, PSMG1 antikoerper, psmg1 antikoerper, psmg1.L antikoerper, psmG1 antikoerper, Psmg1 antikoerper

Hintergrund: PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Molekulargewicht: 33 kDa (MW of target protein)