GBP4 Antikörper (Middle Region)

Produktnummer ABIN630525

Produktdetails anti-GBP4 Antikörper

Target: GBP4 (Guanylate Binding Protein 4 (GBP4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GBP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GBP4 antibody was raised against the middle region of GBP4

Aufreinigung: Affinity purified

Immunogen: GBP4 antibody was raised using the middle region of GBP4 corresponding to a region with amino acids NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GBP4 Blocking Peptide, catalog no. 33R-6647, is also available for use as a blocking control in assays to test for specificity of this GBP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GBP4

Target: GBP4 (Guanylate Binding Protein 4 (GBP4))

Andere Bezeichnung: GBP4 (GBP4 Produkte)

Synonyme: AW228052 antikoerper, Mag-2 antikoerper, Mpa-2 antikoerper, Mpa2 antikoerper, mKIAA4245 antikoerper, Gbp3 antikoerper, MGC108424 antikoerper, GBP4 antikoerper, Gbp4 antikoerper, si:ch211-250m6.1 antikoerper, si:dkey-61p9.3 antikoerper, gbp4 antikoerper, gbp4.L antikoerper, mpa2 antikoerper, guanylate binding protein 4 antikoerper, guanylate-binding protein 4-like antikoerper, guanylate-binding protein 4 antikoerper, guanylate binding protein 4 S homeolog antikoerper, Gbp4 antikoerper, GBP4 antikoerper, gbp4 antikoerper, GBP4L antikoerper, LOC612426 antikoerper, LOC100713243 antikoerper, gbp4.S antikoerper

Hintergrund: GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently, GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation.

Molekulargewicht: 45 kDa (MW of target protein)