NR2F1 Antikörper (C-Term)
-
- Target Alle NR2F1 Antikörper anzeigen
- NR2F1 (Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NR2F1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NR2 F1 antibody was raised against the C terminal of NR2 1
- Aufreinigung
- Affinity purified
- Immunogen
- NR2 F1 antibody was raised using the C terminal of NR2 1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
- Top Product
- Discover our top product NR2F1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NR2F1 Blocking Peptide, catalog no. 33R-9656, is also available for use as a blocking control in assays to test for specificity of this NR2F1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR2F1 (Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1))
- Andere Bezeichnung
- NR2F1 (NR2F1 Produkte)
- Synonyme
- COUP-TFI antikoerper, EAR-3 antikoerper, EAR3 antikoerper, ERBAL3 antikoerper, NR2F2 antikoerper, SVP44 antikoerper, TCFCOUP1 antikoerper, TFCOUP1 antikoerper, COUP-TF1 antikoerper, COUPTFA antikoerper, Erbal3 antikoerper, Tcfcoup1 antikoerper, COUP(VI) antikoerper, couptf6 antikoerper, fc10d05 antikoerper, nr2f1 antikoerper, svp44 antikoerper, wu:fc10d05 antikoerper, COUP-TF antikoerper, ear3 antikoerper, ear-3 antikoerper, nr2f2 antikoerper, erbal3 antikoerper, tfcoup1 antikoerper, coup-tfi antikoerper, tcfcoup1 antikoerper, nr2f1l antikoerper, zgc:65854 antikoerper, zgc:77353 antikoerper, nuclear receptor subfamily 2 group F member 1 antikoerper, nuclear receptor subfamily 2, group F, member 1 antikoerper, nuclear receptor subfamily 2, group F, member 1a antikoerper, nuclear receptor subfamily 2 group F member 1 L homeolog antikoerper, nuclear receptor subfamily 2, group F, member 1b antikoerper, NR2F1 antikoerper, Nr2f1 antikoerper, nr2f1a antikoerper, nr2f1.L antikoerper, nr2f1 antikoerper, nr2f1b antikoerper
- Hintergrund
- Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. NR2F1 binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
-