NR5A1 Antikörper (Middle Region)

Produktnummer ABIN630507

Produktdetails anti-NR5A1 Antikörper

Target: NR5A1 (Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR5A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR5 A1 antibody was raised against the middle region of NR5 1

Aufreinigung: Affinity purified

Immunogen: NR5 A1 antibody was raised using the middle region of NR5 1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR5A1 Blocking Peptide, catalog no. 33R-8589, is also available for use as a blocking control in assays to test for specificity of this NR5A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR5A1

Target: NR5A1 (Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1))

Andere Bezeichnung: NR5A1 (NR5A1 Produkte)

Synonyme: AD4BP antikoerper, ELP antikoerper, FTZ1 antikoerper, FTZF1 antikoerper, POF7 antikoerper, SF-1 antikoerper, SF1 antikoerper, SPGF8 antikoerper, SRXY3 antikoerper, Ad4BP antikoerper, ELP-3 antikoerper, Ftz-F1 antikoerper, Ftzf1 antikoerper, Ad4BP/SF-1 antikoerper, Ad4bp antikoerper, Sf-1 antikoerper, NR5A1 antikoerper, sf-1 antikoerper, elp antikoerper, sf1 antikoerper, ftz1 antikoerper, ad4bp antikoerper, ftzf1 antikoerper, SF-1/Ad4BP antikoerper, SI:zC167P9.2 antikoerper, ff1d antikoerper, nr5a2l antikoerper, nuclear receptor subfamily 5 group A member 1 antikoerper, nuclear receptor subfamily 5, group A, member 1 antikoerper, nuclear receptor subfamily 5 group A member 1 L homeolog antikoerper, nuclear receptor subfamily 6 group A member 1 antikoerper, nuclear receptor subfamily 5, group A, member 1b antikoerper, NR5A1 antikoerper, Nr5a1 antikoerper, nr5a1.L antikoerper, nr5a1 antikoerper, NR6A1 antikoerper, nr5a1b antikoerper

Hintergrund: NR5A1 is an important regulator of steroidogeneis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Maintenance of Protein Location