NR1D1 Antikörper (Middle Region)

Produktnummer ABIN630499

Produktdetails anti-NR1D1 Antikörper

Target: NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1 (NR1D1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR1D1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR1 D1 antibody was raised against the middle region of NR1 1

Aufreinigung: Affinity purified

Immunogen: NR1 D1 antibody was raised using the middle region of NR1 1 corresponding to a region with amino acids SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR1D1 Blocking Peptide, catalog no. 33R-8729, is also available for use as a blocking control in assays to test for specificity of this NR1D1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR1D1

Target: NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1 (NR1D1))

Andere Bezeichnung: NR1D1 (NR1D1 Produkte)

Synonyme: MGC82865 antikoerper, MGC82881 antikoerper, Eip75B antikoerper, EAR1 antikoerper, THRA1 antikoerper, THRAL antikoerper, ear-1 antikoerper, hRev antikoerper, A530070C09Rik antikoerper, R75201 antikoerper, REV-ERBAALPHA antikoerper, nuclear receptor subfamily 1 group D member 1 L homeolog antikoerper, nuclear receptor subfamily 1, group d, member 1 antikoerper, nuclear receptor subfamily 1 group D member 1 antikoerper, nuclear receptor subfamily 1, group D, member 1 antikoerper, nr1d1.L antikoerper, nr1d1 antikoerper, NR1D1 antikoerper, Nr1d1 antikoerper

Hintergrund: NR1D1 belongs to the nuclear hormone receptor family, NR1 subfamily. It contains 1 nuclear receptor DNA-binding domain. NR1D1 functions as a constitutive transcriptional repressor. It is a possible receptor for triiodothyronine.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha