SLC22A7 Antikörper

Produktnummer ABIN630485

Produktdetails anti-SLC22A7 Antikörper

Target: SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: SLC22 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALPNTTLGEERQS

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A7 Blocking Peptide, catalog no. 33R-5265, is also available for use as a blocking control in assays to test for specificity of this SLC22A7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A7

Target: SLC22A7 (Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7))

Andere Bezeichnung: SLC22A7 (SLC22A7 Produkte)

Synonyme: NLT antikoerper, OAT2 antikoerper, Oat2 antikoerper, oat2 antikoerper, nlt antikoerper, slc22a7 antikoerper, im:6901703 antikoerper, im:7155670 antikoerper, oat2a antikoerper, zgc:162334 antikoerper, oat2e antikoerper, slc22a7b antikoerper, zgc:63958 antikoerper, solute carrier family 22 member 7 antikoerper, solute carrier family 22 (organic anion transporter), member 7 antikoerper, solute carrier family 22 (organic anion transporter), member 7 L homeolog antikoerper, solute carrier family 22 (organic anion transporter), member 7a antikoerper, solute carrier family 22 (organic anion transporter), member 7b, tandem duplicate 1 antikoerper, SLC22A7 antikoerper, Slc22a7 antikoerper, slc22a7.L antikoerper, slc22a7a antikoerper, slc22a7b.1 antikoerper

Hintergrund: SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.

Molekulargewicht: 60 kDa (MW of target protein)