TSPAN32 Antikörper (Middle Region)
-
- Target Alle TSPAN32 Antikörper anzeigen
- TSPAN32 (Tetraspanin 32 (TSPAN32))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TSPAN32 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Tetraspanin 32 antibody was raised against the middle region of TSPAN32
- Aufreinigung
- Purified
- Immunogen
- Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
- Top Product
- Discover our top product TSPAN32 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tetraspanin 32 Blocking Peptide, catalog no. 33R-10089, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 32 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN32 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSPAN32 (Tetraspanin 32 (TSPAN32))
- Andere Bezeichnung
- Tetraspanin 32 (TSPAN32 Produkte)
- Synonyme
- TSPAN32 antikoerper, ART1 antikoerper, PHEMX antikoerper, PHMX antikoerper, TSSC6 antikoerper, AW208513 antikoerper, Art-1 antikoerper, BB235973 antikoerper, D7Wsu37e antikoerper, Phemx antikoerper, Tssc6 antikoerper, tetraspanin 32 antikoerper, TSPAN32 antikoerper, Tspan32 antikoerper
- Hintergrund
- This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as hematopoietic cell function.
- Molekulargewicht
- 31 kDa (MW of target protein)
-