TSPAN32 Antikörper (Middle Region)

Produktnummer ABIN630483

Produktdetails anti-TSPAN32 Antikörper

Target: TSPAN32 (Tetraspanin 32 (TSPAN32))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPAN32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: Tetraspanin 32 antibody was raised against the middle region of TSPAN32

Aufreinigung: Purified

Immunogen: Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 32 Blocking Peptide, catalog no. 33R-10089, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPAN32

Target: TSPAN32 (Tetraspanin 32 (TSPAN32))

Andere Bezeichnung: Tetraspanin 32 (TSPAN32 Produkte)

Synonyme: TSPAN32 antikoerper, ART1 antikoerper, PHEMX antikoerper, PHMX antikoerper, TSSC6 antikoerper, AW208513 antikoerper, Art-1 antikoerper, BB235973 antikoerper, D7Wsu37e antikoerper, Phemx antikoerper, Tssc6 antikoerper, tetraspanin 32 antikoerper, TSPAN32 antikoerper, Tspan32 antikoerper

Hintergrund: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as hematopoietic cell function.

Molekulargewicht: 31 kDa (MW of target protein)