WNT16 Antikörper (C-Term)

Produktnummer ABIN630482

Produktdetails anti-WNT16 Antikörper

Target: WNT16 (Wingless-Type MMTV Integration Site Family, Member 16 (WNT16))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WNT16 antibody was raised against the C terminal of WNT16

Aufreinigung: Purified

Immunogen: WNT16 antibody was raised using the C terminal of WNT16 corresponding to a region with amino acids REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT16 Blocking Peptide, catalog no. 33R-7873, is also available for use as a blocking control in assays to test for specificity of this WNT16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT16

Target: WNT16 (Wingless-Type MMTV Integration Site Family, Member 16 (WNT16))

Andere Bezeichnung: WNT16 (WNT16 Produkte)

Synonyme: zgc:77293 antikoerper, E130309I19Rik antikoerper, Wnt family member 16 antikoerper, wingless-type MMTV integration site family, member 16 antikoerper, WNT16 antikoerper, wnt16 antikoerper, Wnt16 antikoerper

Hintergrund: WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT16 contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen.

Molekulargewicht: 38 kDa (MW of target protein)

Pathways: WNT Signalweg