SLC22A11 Antikörper
-
- Target Alle SLC22A11 Antikörper anzeigen
- SLC22A11 (Solute Carrier Family 22 (Organic Cation Transporter), Member 11 (SLC22A11))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SLC22 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
- Top Product
- Discover our top product SLC22A11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A11 Blocking Peptide, catalog no. 33R-5653, is also available for use as a blocking control in assays to test for specificity of this SLC22A11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A11 (Solute Carrier Family 22 (Organic Cation Transporter), Member 11 (SLC22A11))
- Andere Bezeichnung
- SLC22A11 (SLC22A11 Produkte)
- Synonyme
- DKFZp469L1732 antikoerper, OAT4 antikoerper, hOAT4 antikoerper, solute carrier family 22 member 11 antikoerper, solute carrier family 22 member 24 antikoerper, SLC22A11 antikoerper, LOC100349650 antikoerper
- Hintergrund
- SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.
- Molekulargewicht
- 60 kDa (MW of target protein)
-