CYP4F11 Antikörper (N-Term)

Produktnummer ABIN630445

Produktdetails anti-CYP4F11 Antikörper

Target: CYP4F11 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 11 (CYP4F11))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP4F11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP4 F11 antibody was raised against the N terminal of CYP4 11

Aufreinigung: Purified

Immunogen: CYP4 F11 antibody was raised using the N terminal of CYP4 11 corresponding to a region with amino acids FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP4F11 Blocking Peptide, catalog no. 33R-3022, is also available for use as a blocking control in assays to test for specificity of this CYP4F11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP4F11

Target: CYP4F11 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 11 (CYP4F11))

Andere Bezeichnung: CYP4F11 (CYP4F11 Produkte)

Synonyme: CYPIVF11 antikoerper, cytochrome P450, family 4, subfamily F, polypeptide 11 antikoerper, cytochrome P450 family 4 subfamily F member 11 antikoerper, CYP4F11 antikoerper

Hintergrund: CYP4F11 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process