CYP2A13 Antikörper (C-Term)

Produktnummer ABIN630443

Produktdetails anti-CYP2A13 Antikörper

Target: CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2A13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP2 A13 antibody was raised against the C terminal of CYP2 13

Aufreinigung: Purified

Immunogen: CYP2 A13 antibody was raised using the C terminal of CYP2 13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2A13 Blocking Peptide, catalog no. 33R-2112, is also available for use as a blocking control in assays to test for specificity of this CYP2A13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2A13

Target: CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))

Andere Bezeichnung: CYP2A13 (CYP2A13 Produkte)

Synonyme: CPAD antikoerper, CYP2A antikoerper, CYPIIA13 antikoerper, MGC86391 antikoerper, MGC88881 antikoerper, CYP2A13 antikoerper, CYP2A6 antikoerper, cytochrome P450 family 2 subfamily A member 13 antikoerper, cytochrome P450, family 2, subfamily A, polypeptide 13 antikoerper, cytochrome P450 family 2 subfamily A member 13 L homeolog antikoerper, cytochrome P450 family 2 subfamily A polypeptide 13 antikoerper, cytochrome P450 2A13 antikoerper, CYP2A13 antikoerper, cyp2a13.L antikoerper, cyp2a13 antikoerper, LOC540707 antikoerper

Hintergrund: CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.

Molekulargewicht: 54 kDa (MW of target protein)