CYP2D6 Antikörper (N-Term)

Produktnummer ABIN630441

Produktdetails anti-CYP2D6 Antikörper

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP2D6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CYP2 D6 antibody was raised against the N terminal of CYP2 6

Aufreinigung: Purified

Immunogen: CYP2 D6 antibody was raised using the N terminal of CYP2 6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP2D6 Blocking Peptide, catalog no. 33R-8102, is also available for use as a blocking control in assays to test for specificity of this CYP2D6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP2D6

Target: CYP2D6 (Cytochrome P450, Family 2, Subfamily D, Polypeptide 6 (CYP2D6))

Andere Bezeichnung: CYP2D6 (CYP2D6 Produkte)

Synonyme: CPD6 antikoerper, CYP2D antikoerper, CYP2D7AP antikoerper, CYP2D7BP antikoerper, CYP2D7P2 antikoerper, CYP2D8P2 antikoerper, CYP2DL1 antikoerper, CYPIID6 antikoerper, P450-DB1 antikoerper, P450C2D antikoerper, P450DB1 antikoerper, CYP2D42 antikoerper, MGC64445 antikoerper, cyp2d2 antikoerper, cyp2d6-a antikoerper, CYP2D6 antikoerper, cytochrome P450 family 2 subfamily D member 6 antikoerper, cytochrome P450, family 2, subfamily D, polypeptide 6 antikoerper, cytochrome 2D6 antikoerper, cytochrome P450 family 2 subfamily D member 6 S homeolog antikoerper, cytochrome P450 2D6 antikoerper, cytochrome P450 2D6-like antikoerper, CYP2D6 antikoerper, cyp2d6-b antikoerper, cyp2d6.S antikoerper, cyp2d6 antikoerper, LOC100988273 antikoerper

Hintergrund: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug, sparteine and propafenone, both anti-arrythmic drugs, and amitryptiline, an anti-depressant.

Molekulargewicht: 55 kDa (MW of target protein)