SLC25A24 Antikörper
-
- Target Alle SLC25A24 Antikörper anzeigen
- SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A24 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SLC25 A24 antibody was raised using a synthetic peptide corresponding to a region with amino acids FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA
- Top Product
- Discover our top product SLC25A24 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A24 Blocking Peptide, catalog no. 33R-2960, is also available for use as a blocking control in assays to test for specificity of this SLC25A24 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 24 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A24 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 24 (SLC25A24))
- Andere Bezeichnung
- SLC25A24 (SLC25A24 Produkte)
- Synonyme
- SLC25A24 antikoerper, 2610016M12Rik antikoerper, apc1 antikoerper, scamc-1 antikoerper, scamc1-A antikoerper, slc25a24 antikoerper, APC1 antikoerper, SCAMC-1 antikoerper, EFINAL antikoerper, SCAMC1 antikoerper, calcium-binding mitochondrial carrier protein SCaMC-1-like antikoerper, solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24 antikoerper, solute carrier family 25 member 24 antikoerper, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 L homeolog antikoerper, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 antikoerper, LOC534742 antikoerper, Slc25a24 antikoerper, slc25a24.L antikoerper, SLC25A24 antikoerper, slc25a24 antikoerper
- Hintergrund
- SLC25A24 is a calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. It may act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
- Molekulargewicht
- 45 kDa (MW of target protein)
-