SLC22A16 Antikörper
-
- Target Alle SLC22A16 Antikörper anzeigen
- SLC22A16 (Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16))
- Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC22A16 Antikörper ist unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Aufreinigung
- Purified
- Immunogen
- SLC22 A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
- Top Product
- Discover our top product SLC22A16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC22A16 Blocking Peptide, catalog no. 33R-1816, is also available for use as a blocking control in assays to test for specificity of this SLC22A16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A16 (Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16))
- Andere Bezeichnung
- SLC22A16 (SLC22A16 Produkte)
- Synonyme
- CT2 antikoerper, FLIPT2 antikoerper, OAT6 antikoerper, OCT6 antikoerper, OKB1 antikoerper, dJ261K5.1 antikoerper, slc22a16 antikoerper, 4921504E14Rik antikoerper, solute carrier family 22 member 16 antikoerper, solute carrier family 22 member 16 L homeolog antikoerper, solute carrier family 22 (organic cation transporter), member 16 antikoerper, SLC22A16 antikoerper, slc22a16.L antikoerper, Slc22a16 antikoerper
- Hintergrund
- Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).
- Molekulargewicht
- 63 kDa (MW of target protein)
-