KCNC1 Antikörper (N-Term)
-
- Target Alle KCNC1 Antikörper anzeigen
- KCNC1 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 1 (KCNC1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- KCNC1 antibody was raised against the N terminal of KCNC1
- Aufreinigung
- Purified
- Immunogen
- KCNC1 antibody was raised using the N terminal of KCNC1 corresponding to a region with amino acids TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY
- Top Product
- Discover our top product KCNC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNC1 Blocking Peptide, catalog no. 33R-9400, is also available for use as a blocking control in assays to test for specificity of this KCNC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNC1 (Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 1 (KCNC1))
- Andere Bezeichnung
- KCNC1 (KCNC1 Produkte)
- Synonyme
- kv3.1 antikoerper, C230009H10Rik antikoerper, KShIIIB antikoerper, KV4 antikoerper, Kcr2-1 antikoerper, Kv3.1 antikoerper, NGK2 antikoerper, Shaw antikoerper, Kv4 antikoerper, NGK2-KV4 antikoerper, KV3.1 antikoerper, KCNC2 antikoerper, zgc:194940 antikoerper, zgc:194950 antikoerper, potassium voltage-gated channel subfamily C member 1 antikoerper, potassium voltage-gated channel, Shaw-related subfamily, member 1 antikoerper, potassium voltage gated channel, Shaw-related subfamily, member 1 antikoerper, potassium voltage-gated channel, Shaw-related subfamily, member 1a antikoerper, KCNC1 antikoerper, kcnc1 antikoerper, Kcnc1 antikoerper, kcnc1a antikoerper
- Hintergrund
- KCNC1 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.
- Molekulargewicht
- 58 kDa (MW of target protein)
-