SLCO6A1 Antikörper (C-Term)
-
- Target Alle SLCO6A1 Antikörper anzeigen
- SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLCO6A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLCO6 A1 antibody was raised against the C terminal of SLCO6 1
- Aufreinigung
- Purified
- Immunogen
- SLCO6 A1 antibody was raised using the C terminal of SLCO6 1 corresponding to a region with amino acids LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK
- Top Product
- Discover our top product SLCO6A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLCO6A1 Blocking Peptide, catalog no. 33R-4785, is also available for use as a blocking control in assays to test for specificity of this SLCO6A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))
- Andere Bezeichnung
- SLCO6A1 (SLCO6A1 Produkte)
- Synonyme
- CT48 antikoerper, GST antikoerper, OATP6A1 antikoerper, OATPY antikoerper, SLCO6A1 antikoerper, solute carrier organic anion transporter family member 6A1 antikoerper, SLCO6A1 antikoerper
- Hintergrund
- SLCO6A1 is involved in transporter activity (solute carrier).
- Molekulargewicht
- 79 kDa (MW of target protein)
-