SLC7A8 Antikörper

Produktnummer ABIN630365

Produktdetails anti-SLC7A8 Antikörper

Target: SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC7A8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: SLC7 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC7A8 Blocking Peptide, catalog no. 33R-7317, is also available for use as a blocking control in assays to test for specificity of this SLC7A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC7A8

Target: SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))

Andere Bezeichnung: SLC7A8 (SLC7A8 Produkte)

Synonyme: LAT2 antikoerper, LPI-PC1 antikoerper, Lat2 antikoerper, Lat4 antikoerper, XAA2 antikoerper, lat2 antikoerper, lpi-pc1 antikoerper, 4F2LC-5 antikoerper, AA408822 antikoerper, si:ch211-14a17.3 antikoerper, si:zc14a17.3 antikoerper, slc7a8 antikoerper, solute carrier family 7 member 8 antikoerper, solute carrier family 7 member 8 L homeolog antikoerper, solute carrier family 7 (amino acid transporter, L-type), member 8 antikoerper, solute carrier family 7 (cationic amino acid transporter, y+ system), member 8 antikoerper, solute carrier family 7 (amino acid transporter light chain, L system), member 8b antikoerper, SLC7A8 antikoerper, Slc7a8 antikoerper, slc7a8.L antikoerper, slc7a8 antikoerper, slc7a8b antikoerper

Hintergrund: SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.

Molekulargewicht: 37 kDa (MW of target protein)