GJB4 Antikörper (Middle Region)

Produktnummer ABIN630263

Produktdetails anti-GJB4 Antikörper

Target: GJB4 (Gap Junction Protein, beta 4, 30.3kDa (GJB4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GJB4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GJB4 antibody was raised against the middle region of GJB4

Aufreinigung: Purified

Immunogen: GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GJB4 Blocking Peptide, catalog no. 33R-1774, is also available for use as a blocking control in assays to test for specificity of this GJB4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GJB4

Target: GJB4 (Gap Junction Protein, beta 4, 30.3kDa (GJB4))

Andere Bezeichnung: GJB4 (GJB4 Produkte)

Hintergrund: Connexins are homologous four-transmembrane-domain proteins and major components of gap junctions. The GJB4 gene encodes connexin 30.3 (Cx30.3) A mutation in connexin 30.3 is causally involved in erythrokeratodermia variabilis (EKV), a mostly autosomal dominant disorder of keratinization.

Molekulargewicht: 29 kDa (MW of target protein)