ZDHHC13 Antikörper (N-Term)
-
- Target Alle ZDHHC13 Antikörper anzeigen
- ZDHHC13 (Zinc Finger, DHHC-Type Containing 13 (ZDHHC13))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZDHHC13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ZDHHC13 antibody was raised against the N terminal of ZDHHC13
- Aufreinigung
- Purified
- Immunogen
- ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
- Top Product
- Discover our top product ZDHHC13 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZDHHC13 Blocking Peptide, catalog no. 33R-6586, is also available for use as a blocking control in assays to test for specificity of this ZDHHC13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC13 (Zinc Finger, DHHC-Type Containing 13 (ZDHHC13))
- Andere Bezeichnung
- ZDHHC13 (ZDHHC13 Produkte)
- Synonyme
- ZDHHC13 antikoerper, 2410004E01Rik antikoerper, C530010M18 antikoerper, HIP3RP antikoerper, Hip14l antikoerper, kojak antikoerper, skc4 antikoerper, wu:fb06e01 antikoerper, wu:fc39g10 antikoerper, wu:fi22e09 antikoerper, zgc:101690 antikoerper, HIP14L antikoerper, zinc finger DHHC-type containing 13 antikoerper, zinc finger, DHHC domain containing 13 antikoerper, zinc finger, DHHC-type containing 13 antikoerper, ZDHHC13 antikoerper, Zdhhc13 antikoerper, zdhhc13 antikoerper
- Hintergrund
- ZDHHC13 may be involved in the NF-kappa-B signaling pathway.
- Molekulargewicht
- 54 kDa (MW of target protein)
-