WNT9B Antikörper (C-Term)

Produktnummer ABIN630146

Produktdetails anti-WNT9B Antikörper

Target: WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT9B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: WNT9 B antibody was raised against the C terminal of WNT9

Aufreinigung: Purified

Immunogen: WNT9 B antibody was raised using the C terminal of WNT9 corresponding to a region with amino acids FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT9B Blocking Peptide, catalog no. 33R-3045, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT9B

Target: WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))

Andere Bezeichnung: WNT9B (WNT9B Produkte)

Synonyme: WNT14B antikoerper, WNT15 antikoerper, WNT9B antikoerper, wnt-9b antikoerper, Wnt14b antikoerper, Wnt15 antikoerper, clf antikoerper, clf1 antikoerper, wnt-14b antikoerper, wnt-15 antikoerper, Wnt family member 9B antikoerper, wingless-type MMTV integration site family member 9B L homeolog antikoerper, protein Wnt-9b antikoerper, wingless-type MMTV integration site family, member 9B antikoerper, WNT9B antikoerper, wnt9b.2.L antikoerper, Wnt9b antikoerper, LOC468296 antikoerper, wnt9b antikoerper

Hintergrund: WNT9B is a member of the WNT family. They are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: WNT Signalweg, Tube Formation