TRPM3 Antikörper (N-Term)
-
- Target Alle TRPM3 Antikörper anzeigen
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRPM3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRPM3 antibody was raised against the N terminal of TRPM3
- Aufreinigung
- Purified
- Immunogen
- TRPM3 antibody was raised using the N terminal of TRPM3 corresponding to a region with amino acids ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD
- Top Product
- Discover our top product TRPM3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRPM3 Blocking Peptide, catalog no. 33R-1376, is also available for use as a blocking control in assays to test for specificity of this TRPM3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRPM3 (Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3))
- Andere Bezeichnung
- TRPM3 (TRPM3 Produkte)
- Synonyme
- GON-2 antikoerper, LTRPC3 antikoerper, MLSN2 antikoerper, 6330504P12Rik antikoerper, 9330180E14 antikoerper, AU018608 antikoerper, B930001P07Rik antikoerper, si:dkey-201c13.4 antikoerper, trpm6 antikoerper, transient receptor potential cation channel subfamily M member 3 antikoerper, transient receptor potential cation channel, subfamily M, member 3 antikoerper, TRPM3 antikoerper, Trpm3 antikoerper, trpm3 antikoerper
- Hintergrund
- TRPM3 encodes a protein that belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The encoded protein mediates calcium entry, and this entry is potentiated by calcium store depletion.
- Molekulargewicht
- 188 kDa (MW of target protein)
-