CACNG4 Antikörper (N-Term)

Produktnummer ABIN630108

Produktdetails anti-CACNG4 Antikörper

Target: CACNG4 (Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CACNG4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CACNG4 antibody was raised against the N terminal of CACNG4

Aufreinigung: Purified

Immunogen: CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL

Anwendungsinformationen

Applikationshinweise: WB: 0.31 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CACNG4 Blocking Peptide, catalog no. 33R-3480, is also available for use as a blocking control in assays to test for specificity of this CACNG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CACNG4

Target: CACNG4 (Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4))

Andere Bezeichnung: CACNG4 (CACNG4 Produkte)

Synonyme: CACNG4 antikoerper, AI413107 antikoerper, AW491861 antikoerper, calcium voltage-gated channel auxiliary subunit gamma 4 antikoerper, calcium channel, voltage-dependent, gamma subunit 4 antikoerper, CACNG4 antikoerper, Cacng4 antikoerper

Hintergrund: L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits.

Molekulargewicht: 36 kDa (MW of target protein)