CHRNA5 Antikörper (Middle Region)

Produktnummer ABIN630102

Produktdetails anti-CHRNA5 Antikörper

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRNA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHRNA5 antibody was raised against the middle region of CHRNA5

Aufreinigung: Purified

Immunogen: CHRNA5 antibody was raised using the middle region of CHRNA5 corresponding to a region with amino acids DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHRNA5 Blocking Peptide, catalog no. 33R-1967, is also available for use as a blocking control in assays to test for specificity of this CHRNA5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHRNA5

Target: CHRNA5 (Cholinergic Receptor, Nicotinic, alpha 5 (Neuronal) (CHRNA5))

Andere Bezeichnung: CHRNA5 (CHRNA5 Produkte)

Synonyme: zgc:110642 antikoerper, LNCR2 antikoerper, Acra-5 antikoerper, Acra5 antikoerper, cholinergic receptor, nicotinic, alpha 5 antikoerper, cholinergic receptor nicotinic alpha 5 subunit antikoerper, cholinergic receptor nicotinic alpha 5 subunit L homeolog antikoerper, cholinergic receptor, nicotinic, alpha polypeptide 5 antikoerper, chrna5 antikoerper, CHRNA5 antikoerper, chrna5.L antikoerper, Chrna5 antikoerper

Hintergrund: Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits.

Molekulargewicht: 53 kDa (MW of target protein)