P2RX7 Antikörper (N-Term)
-
- Target Alle P2RX7 Antikörper anzeigen
- P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser P2RX7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- P2 RX7 antibody was raised against the N terminal of P2 X7
- Aufreinigung
- Purified
- Immunogen
- P2 RX7 antibody was raised using the N terminal of P2 X7 corresponding to a region with amino acids IQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAE
- Top Product
- Discover our top product P2RX7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
P2RX7 Blocking Peptide, catalog no. 33R-4125, is also available for use as a blocking control in assays to test for specificity of this P2RX7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))
- Andere Bezeichnung
- P2RX7 (P2RX7 Produkte)
- Synonyme
- p2xr7 antikoerper, P2RX7 antikoerper, P2X7 antikoerper, AI467586 antikoerper, P2X(7) antikoerper, P2X7R antikoerper, p2x7 antikoerper, purinergic receptor P2X 7 antikoerper, purinergic receptor P2X, ligand-gated ion channel, 7 antikoerper, P2X purinoceptor 7 antikoerper, P2RX7 antikoerper, p2rx7 antikoerper, LOC100458463 antikoerper, P2rx7 antikoerper
- Hintergrund
- The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis
-