KCNH6 Antikörper

Produktnummer ABIN630086

Produktdetails anti-KCNH6 Antikörper

Target: KCNH6 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 6 (KCNH6))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNH6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNH6 Blocking Peptide, catalog no. 33R-3382, is also available for use as a blocking control in assays to test for specificity of this KCNH6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNH6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNH6

Target: KCNH6 (Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 6 (KCNH6))

Andere Bezeichnung: KCNH6 (KCNH6 Produkte)

Synonyme: KCNH2 antikoerper, erg antikoerper, ERG-2 antikoerper, ERG2 antikoerper, HERG2 antikoerper, Kv11.2 antikoerper, hERG-2 antikoerper, m-erg2 antikoerper, Erg2 antikoerper, potassium voltage-gated channel subfamily H member 6 antikoerper, potassium voltage-gated channel, subfamily H (eag-related), member 6 antikoerper, KCNH6 antikoerper, Kcnh6 antikoerper

Hintergrund: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNH6 encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit.

Molekulargewicht: 109 kDa (MW of target protein)