CACNG6 Antikörper (N-Term)
-
- Target Alle CACNG6 Antikörper anzeigen
- CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CACNG6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CACNG6 antibody was raised against the N terminal of CACNG6
- Aufreinigung
- Purified
- Immunogen
- CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN
- Top Product
- Discover our top product CACNG6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CACNG6 Blocking Peptide, catalog no. 33R-7808, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CACNG6 (Calcium Channel, Voltage-Dependent, gamma Subunit 6 (CACNG6))
- Andere Bezeichnung
- CACNG6 (CACNG6 Produkte)
- Synonyme
- CACNG6 antikoerper, cacng6 antikoerper, MGC122711 antikoerper, 2310033H20Rik antikoerper, AW050150 antikoerper, calcium voltage-gated channel auxiliary subunit gamma 6 antikoerper, calcium channel, voltage-dependent, gamma subunit 6 antikoerper, CACNG6 antikoerper, cacng6 antikoerper, Cacng6 antikoerper
- Hintergrund
- L-type calcium channels are composed of five subunits. The protein encoded by CACNG6 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. CACNG6 is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two similar gamma subunit-encoding genes.
- Molekulargewicht
- 24 kDa (MW of target protein)
-