KCNAB2 Antikörper (Middle Region)

Produktnummer ABIN630059

Produktdetails anti-KCNAB2 Antikörper

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Bindungsspezifität: Middle Region

Reaktivität: Ratte, Human, Maus, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNAB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: KCNAB2 antibody was raised against the middle region of KCNAB2

Aufreinigung: Purified

Immunogen: KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNAB2 Blocking Peptide, catalog no. 33R-9950, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNAB2

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Andere Bezeichnung: KCNAB2 (KCNAB2 Produkte)

Synonyme: kcnab2 antikoerper, KCNAB2 antikoerper, DKFZp459E056 antikoerper, akr6a5 antikoerper, kcna2b antikoerper, kvb-a antikoerper, kvb2 antikoerper, kvbeta2 antikoerper, kvbeta2.1 antikoerper, kvbeta2.2 antikoerper, AKR6A5 antikoerper, HKvbeta2 antikoerper, HKvbeta2.1 antikoerper, HKvbeta2.2 antikoerper, KCNA2B antikoerper, KV-BETA-2 antikoerper, Kvbeta2.1 antikoerper, F5 antikoerper, I2rf5 antikoerper, Kcnb3 antikoerper, kv-beta-2 antikoerper, potassium channel, voltage gated subfamily A regulatory beta subunit 1 antikoerper, potassium voltage-gated channel subfamily A regulatory beta subunit 2 antikoerper, potassium voltage-gated channel, shaker-related subfamily, beta member 2 a antikoerper, potassium channel, voltage gated subfamily A regulatory beta subunit 2 L homeolog antikoerper, voltage-gated potassium channel subunit beta-2 antikoerper, potassium voltage-gated channel, shaker-related subfamily, beta member 2 antikoerper, kcnab1 antikoerper, KCNAB2 antikoerper, kcnab2a antikoerper, kcnab2.L antikoerper, LOC397248 antikoerper, Kcnab2 antikoerper

Hintergrund: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Molekulargewicht: 40 kDa (MW of target protein)