KCNAB2 Antikörper (Middle Region)

Produktnummer ABIN630059

Der Kaninchen Polyklonal anti-KCNAB2 Antikörper wird verwendet zum Nachweis von KCNAB2 in Proben von Ratte, Human, Maus, Hund und Zebrafisch (Danio rerio). Er wurde validiert für WB und IHC.

Kurzübersicht für KCNAB2 Antikörper (Middle Region) (ABIN630059)

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Reaktivität: Ratte, Human, Maus, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNAB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-KCNAB2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: KCNAB2 antibody was raised against the middle region of KCNAB2

Aufreinigung: Purified

Immunogen: KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNAB2 Blocking Peptide, (ABIN5614261), is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNAB2

Target: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Andere Bezeichnung: KCNAB2

Hintergrund: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Molekulargewicht: 40 kDa (MW of target protein)