KCNAB3 Antikörper (N-Term)
-
- Target Alle KCNAB3 Antikörper anzeigen
- KCNAB3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 3 (KCNAB3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser KCNAB3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- KCNAB3 antibody was raised against the N terminal of KCNAB3
- Aufreinigung
- Purified
- Immunogen
- KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV
- Top Product
- Discover our top product KCNAB3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.65 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
KCNAB3 Blocking Peptide, catalog no. 33R-8079, is also available for use as a blocking control in assays to test for specificity of this KCNAB3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNAB3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 3 (KCNAB3))
- Andere Bezeichnung
- KCNAB3 (KCNAB3 Produkte)
- Synonyme
- KCNAB3 antikoerper, AKR6A9 antikoerper, KCNA3.1B antikoerper, KCNA3B antikoerper, KV-BETA-3 antikoerper, C330022D06Rik antikoerper, Kcnab4 antikoerper, mKv(beta)4 antikoerper, akr6a9 antikoerper, kcna3.1b antikoerper, kcna3b antikoerper, kcnb4-A antikoerper, kv-beta-3 antikoerper, kvb-b antikoerper, kvb4 antikoerper, xKvbeta4 antikoerper, potassium voltage-gated channel subfamily A regulatory beta subunit 3 antikoerper, potassium voltage-gated channel, shaker-related subfamily, beta member 3 antikoerper, potassium channel, voltage gated subfamily A regulatory beta subunit 3 L homeolog antikoerper, KCNAB3 antikoerper, Kcnab3 antikoerper, kcnab3.L antikoerper
- Hintergrund
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s).
- Molekulargewicht
- 44 kDa (MW of target protein)
-