LSM2 Antikörper

Produktnummer ABIN630011

Produktdetails anti-LSM2 Antikörper

Target: LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LSM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: LSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LSM2 Blocking Peptide, catalog no. 33R-9016, is also available for use as a blocking control in assays to test for specificity of this LSM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LSM2

Target: LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))

Andere Bezeichnung: LSM2 (LSM2 Produkte)

Synonyme: LSM2 antikoerper, 61.t00040 antikoerper, 18.m06211 antikoerper, 18.m06235 antikoerper, lsm2 antikoerper, C6orf28 antikoerper, G7B antikoerper, YBL026W antikoerper, snRNP antikoerper, D17H6S56E-2 antikoerper, D17H6S56E2 antikoerper, Dmapl antikoerper, Dmpkap antikoerper, G7b antikoerper, Sm-X5 antikoerper, SmX5 antikoerper, wu:fe48h10 antikoerper, zgc:101795 antikoerper, LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated antikoerper, U6 snRNA-associated sm-like protein Lsm2, putative antikoerper, u6 snRNA-associated sm-like protein lsm2 antikoerper, U6 snRNA-associated Sm-like protein LSm2 antikoerper, U6 snRNA-associated Sm-like protein LSm2, putative antikoerper, u6 snRNA-associated sm-like protein Lsm2 antikoerper, U6 snRNA-associated sm-like protein Lsm2,putative antikoerper, u6 snRNA-associated sm-like protein lsm2, putative antikoerper, LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog antikoerper, smx5 antikoerper, LSM2 antikoerper, PFE1020w antikoerper, CNC01770 antikoerper, EHI_068580 antikoerper, PCHAS_123570 antikoerper, BBOV_II002620 antikoerper, BBOV_II002860 antikoerper, EBI_26471 antikoerper, Bm1_23515 antikoerper, PKH_101210 antikoerper, CGB_C2600W antikoerper, lsm2 antikoerper, lsm2.S antikoerper, Lsm2 antikoerper, smx5 antikoerper

Hintergrund: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molekulargewicht: 10 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization