MRM1 Antikörper

Produktnummer ABIN629965

Produktdetails anti-MRM1 Antikörper

Target: MRM1 (Mitochondrial rRNA Methyltransferase 1 Homolog (MRM1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Purified

Immunogen: MRM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRM1 Blocking Peptide, catalog no. 33R-3623, is also available for use as a blocking control in assays to test for specificity of this MRM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRM1

Target: MRM1 (Mitochondrial rRNA Methyltransferase 1 Homolog (MRM1))

Andere Bezeichnung: MRM1 (MRM1 Produkte)

Synonyme: A530065E19Rik antikoerper, ENSMUSG00000054212 antikoerper, RGD1566232 antikoerper, mitochondrial rRNA methyltransferase 1 antikoerper, MRM1 antikoerper, Mrm1 antikoerper

Hintergrund: MRM1 belongs to the RNA methyltransferase trmH family and probably methylates the ribose of guanosine G-2270 in the peptidyl transferase center of the mitochondrial large ribosomal RNA (21S)

Molekulargewicht: 18 kDa (MW of target protein)