NUDT16L1 Antikörper

Produktnummer ABIN629838

Produktdetails anti-NUDT16L1 Antikörper

Target: NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUDT16L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: NUDT16 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUDT16L1 Blocking Peptide, catalog no. 33R-3430, is also available for use as a blocking control in assays to test for specificity of this NUDT16L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDT10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUDT16L1

Target: NUDT16L1 (Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 16-Like 1 (NUDT16L1))

Andere Bezeichnung: NUDT16L1 (NUDT16L1 Produkte)

Synonyme: SDOS antikoerper, 1110001K21Rik antikoerper, 5330437I08Rik antikoerper, Sdos antikoerper, nudix hydrolase 16 like 1 antikoerper, nudix (nucleoside diphosphate linked moiety X)-type motif 16-like 1 antikoerper, NUDT16L1 antikoerper, Nudt16l1 antikoerper

Hintergrund: NUDT16L1 is a probable adapter protein, which may link syndecan-4 (SDC4) and paxilin (TGFB1I1 and PXN) receptors.

Molekulargewicht: 23 kDa (MW of target protein)