14-3-3 zeta Antikörper (C-Term)

Produktnummer ABIN629824

Produktdetails anti-14-3-3 zeta Antikörper

Target: 14-3-3 zeta (YWHAZ)

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser 14-3-3 zeta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: YWHAZ antibody was raised against the C terminal of YWHAZ

Aufreinigung: Purified

Immunogen: YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

YWHAZ Blocking Peptide, catalog no. 33R-1158, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu 14-3-3 zeta

Target: 14-3-3 zeta (YWHAZ)

Andere Bezeichnung: YWHAZ (YWHAZ Produkte)

Synonyme: 14-3-3-zeta antikoerper, KCIP-1 antikoerper, YWHAD antikoerper, 14-3-3zeta antikoerper, Ywhaz antikoerper, ACYPI003154 antikoerper, 14-3-3z antikoerper, kcip-1 antikoerper, ywhaq antikoerper, 1433z antikoerper, ywhaz antikoerper, ywhazb antikoerper, 1110013I11Rik antikoerper, AI596267 antikoerper, AL022924 antikoerper, AU020854 antikoerper, ywhaza antikoerper, fb14h09 antikoerper, wu:fb05g08 antikoerper, wu:fb14h09 antikoerper, ywhai antikoerper, zgc:55807 antikoerper, 14-3-3 antikoerper, 14-3-3 zeta antikoerper, 14-3-3ZETA antikoerper, 14-3-3leo antikoerper, 2G1 antikoerper, 4-3-3 zeta antikoerper, 5.11 antikoerper, 549 antikoerper, BEST:GH05075 antikoerper, CG17870 antikoerper, D14-3-3 antikoerper, D14-3-3zeta antikoerper, Dmel\\CG17870 antikoerper, K antikoerper, LEO antikoerper, Leo antikoerper, PAR-5 antikoerper, PAR5 antikoerper, Par-5 antikoerper, d14-3-3zeta antikoerper, l(2)07103 antikoerper, l(2)46CFe antikoerper, l(2)46Ee antikoerper, leo antikoerper, par-5 antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antikoerper, 14-3-3 protein zeta antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antikoerper, 14-3-3 protein zeta/delta pseudogene antikoerper, CG17870 gene product from transcript CG17870-RE antikoerper, YWHAZ antikoerper, 14-3-3zeta antikoerper, ywhaz antikoerper, 1433z antikoerper, ywhaz.L antikoerper, Ywhaz antikoerper, ywhaz.S antikoerper, LOC100855903 antikoerper

Hintergrund: YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location