NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (Middle Region) Antikörper

Produktnummer ABIN629701

Produktdetails

Target: NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NELF antibody was raised against the middle region of NELF

Aufreinigung: Purified

Immunogen: NELF antibody was raised using the middle region of NELF corresponding to a region with amino acids RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NELF Blocking Peptide, catalog no. 33R-7887, is also available for use as a blocking control in assays to test for specificity of this NELF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELF antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)

Andere Bezeichnung: NELF (NSMF Produkte)

Synonyme: HH9 antikoerper, NELF antikoerper, NMDA receptor synaptonuclear signaling and neuronal migration factor antikoerper, NSMF antikoerper

Hintergrund: NELF influences outgrowth of olfactory axons and migration of LHRH neurons.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Synaptic Membrane