NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) (Middle Region) Antikörper
-
- Target Alle NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF) Antikörper anzeigen
- NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NELF antibody was raised against the middle region of NELF
- Aufreinigung
- Purified
- Immunogen
- NELF antibody was raised using the middle region of NELF corresponding to a region with amino acids RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG
- Top Product
- Discover our top product NSMF Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NELF Blocking Peptide, catalog no. 33R-7887, is also available for use as a blocking control in assays to test for specificity of this NELF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NELF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NMDA Receptor Synaptonuclear Signaling and Neuronal Migration Factor (NSMF)
- Andere Bezeichnung
- NELF (NSMF Produkte)
- Synonyme
- HH9 antikoerper, NELF antikoerper, NMDA receptor synaptonuclear signaling and neuronal migration factor antikoerper, NSMF antikoerper
- Hintergrund
- NELF influences outgrowth of olfactory axons and migration of LHRH neurons.
- Molekulargewicht
- 29 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-