NDUFV1 Antikörper

Produktnummer ABIN629687

Produktdetails anti-NDUFV1 Antikörper

Target: NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NDUFV1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: NDUFV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NDUFV1 Blocking Peptide, catalog no. 33R-2999, is also available for use as a blocking control in assays to test for specificity of this NDUFV1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFV1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NDUFV1

Target: NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))

Andere Bezeichnung: NDUFV1 (NDUFV1 Produkte)

Synonyme: GB17095 antikoerper, uqor1 antikoerper, DDBDRAFT_0188174 antikoerper, DDBDRAFT_0191420 antikoerper, DDB_0188174 antikoerper, DDB_0191420 antikoerper, wu:fc01f01 antikoerper, wu:fc12f12 antikoerper, zgc:86620 antikoerper, CI-51kD antikoerper, CI-51K antikoerper, CI51KD antikoerper, UQOR1 antikoerper, NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial antikoerper, NADH:ubiquinone oxidoreductase core subunit V1 antikoerper, NADH dehydrogenase ubiquinone flavoprotein 1 antikoerper, NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa antikoerper, NADH dehydrogenase (ubiquinone) flavoprotein 1 antikoerper, NADH:ubiquinone oxidoreductase core subunit V1 L homeolog antikoerper, LOC408367 antikoerper, NDUFV1 antikoerper, ndufv1 antikoerper, Ndufv1 antikoerper, LOC100179486 antikoerper, ndufv1.L antikoerper

Hintergrund: The NDUFV1 gene encodes the 51 kDa subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.

Molekulargewicht: 51 kDa (MW of target protein)