ATP5B Antikörper (C-Term)

Produktnummer ABIN629673

Produktdetails anti-ATP5B Antikörper

Target: ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP5 B antibody was raised against the C terminal of ATP5

Aufreinigung: Purified

Immunogen: ATP5 B antibody was raised using the C terminal of ATP5 corresponding to a region with amino acids MGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEH

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP5B Blocking Peptide, catalog no. 33R-6043, is also available for use as a blocking control in assays to test for specificity of this ATP5B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP5B

Target: ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))

Andere Bezeichnung: ATP5B (ATP5B Produkte)

Synonyme: atpmb antikoerper, atpsb antikoerper, Atpsyn-beta antikoerper, hm:zehn0534 antikoerper, im:6793121 antikoerper, wu:fj38d01 antikoerper, zgc:111961 antikoerper, ATPMB antikoerper, ATPSB antikoerper, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide antikoerper, ATP synthase subunit beta, mitochondrial antikoerper, ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit antikoerper, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide S homeolog antikoerper, ATP5B antikoerper, atp5b antikoerper, Atp5b antikoerper, LOC100401662 antikoerper, LOC100635763 antikoerper, atp5b.S antikoerper

Hintergrund: ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process