ECHS1 Antikörper (Middle Region)

Produktnummer ABIN629671

Produktdetails anti-ECHS1 Antikörper

Target: ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ECHS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ECHS1 antibody was raised against the middle region of ECHS1

Aufreinigung: Purified

Immunogen: ECHS1 antibody was raised using the middle region of ECHS1 corresponding to a region with amino acids RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA

Anwendungsinformationen

Applikationshinweise: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ECHS1 Blocking Peptide, catalog no. 33R-7826, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ECHS1

Target: ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))

Andere Bezeichnung: ECHS1 (ECHS1 Produkte)

Synonyme: SCEH antikoerper, cOR6not antikoerper, fj55e05 antikoerper, si:zc217g15.1 antikoerper, wu:fj55e05 antikoerper, C80529 antikoerper, enoyl-CoA hydratase, short chain, 1, mitochondrial L homeolog antikoerper, enoyl-CoA hydratase, short chain 1 antikoerper, enoyl CoA hydratase, short chain, 1, mitochondrial antikoerper, enoyl Coenzyme A hydratase, short chain, 1, mitochondrial antikoerper, echs1.L antikoerper, ECHS1 antikoerper, Echs1 antikoerper, echs1 antikoerper

Hintergrund: ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process