ECHS1 Antikörper (Middle Region)
-
- Target Alle ECHS1 Antikörper anzeigen
- ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ECHS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ECHS1 antibody was raised against the middle region of ECHS1
- Aufreinigung
- Purified
- Immunogen
- ECHS1 antibody was raised using the middle region of ECHS1 corresponding to a region with amino acids RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA
- Top Product
- Discover our top product ECHS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ECHS1 Blocking Peptide, catalog no. 33R-7826, is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))
- Andere Bezeichnung
- ECHS1 (ECHS1 Produkte)
- Synonyme
- SCEH antikoerper, cOR6not antikoerper, fj55e05 antikoerper, si:zc217g15.1 antikoerper, wu:fj55e05 antikoerper, C80529 antikoerper, enoyl-CoA hydratase, short chain, 1, mitochondrial L homeolog antikoerper, enoyl-CoA hydratase, short chain 1 antikoerper, enoyl CoA hydratase, short chain, 1, mitochondrial antikoerper, enoyl Coenzyme A hydratase, short chain, 1, mitochondrial antikoerper, echs1.L antikoerper, ECHS1 antikoerper, Echs1 antikoerper, echs1 antikoerper
- Hintergrund
- ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-