WNT2B Antikörper (Middle Region)
-
- Target Alle WNT2B Antikörper anzeigen
- WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WNT2B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- WNT2 B antibody was raised against the middle region of WNT2
- Aufreinigung
- Purified
- Immunogen
- WNT2 B antibody was raised using the middle region of WNT2 corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT
- Top Product
- Discover our top product WNT2B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))
- Andere Bezeichnung
- WNT2B (WNT2B Produkte)
- Synonyme
- WNT13 antikoerper, XWNT2 antikoerper, wnt2b antikoerper, XWnt-2 antikoerper, Xwnt-2b antikoerper, wnt-2b antikoerper, xwnt2b antikoerper, WNT2B antikoerper, Wnt13 antikoerper, Wnt family member 2B antikoerper, wingless-type MMTV integration site family, member 2Ba antikoerper, Wnt family member 2B L homeolog antikoerper, wingless-type MMTV integration site family, member 2B antikoerper, wingless-type MMTV integration site family, member 2Bb antikoerper, WNT2B antikoerper, Wnt2b antikoerper, wnt2ba antikoerper, wnt2b.L antikoerper, wnt2bb antikoerper
- Hintergrund
- WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- WNT Signalweg
-