WNT2B Antikörper (Middle Region)

Produktnummer ABIN629639

Produktdetails anti-WNT2B Antikörper

Target: WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WNT2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: WNT2 B antibody was raised against the middle region of WNT2

Aufreinigung: Purified

Immunogen: WNT2 B antibody was raised using the middle region of WNT2 corresponding to a region with amino acids LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WNT2B Blocking Peptide, catalog no. 33R-10585, is also available for use as a blocking control in assays to test for specificity of this WNT2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WNT2B

Target: WNT2B (Wingless-Type MMTV Integration Site Family, Member 2B (WNT2B))

Andere Bezeichnung: WNT2B (WNT2B Produkte)

Synonyme: WNT13 antikoerper, XWNT2 antikoerper, wnt2b antikoerper, XWnt-2 antikoerper, Xwnt-2b antikoerper, wnt-2b antikoerper, xwnt2b antikoerper, WNT2B antikoerper, Wnt13 antikoerper, Wnt family member 2B antikoerper, wingless-type MMTV integration site family, member 2Ba antikoerper, Wnt family member 2B L homeolog antikoerper, wingless-type MMTV integration site family, member 2B antikoerper, wingless-type MMTV integration site family, member 2Bb antikoerper, WNT2B antikoerper, Wnt2b antikoerper, wnt2ba antikoerper, wnt2b.L antikoerper, wnt2bb antikoerper

Hintergrund: WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as human carcinogenesis.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: WNT Signalweg