RNF38 Antikörper (N-Term)
-
- Target Alle RNF38 Antikörper anzeigen
- RNF38 (Ring Finger Protein 38 (RNF38))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF38 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNF38 antibody was raised against the N terminal of RNF38
- Aufreinigung
- Purified
- Immunogen
- RNF38 antibody was raised using the N terminal of RNF38 corresponding to a region with amino acids FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP
- Top Product
- Discover our top product RNF38 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF38 Blocking Peptide, catalog no. 33R-2874, is also available for use as a blocking control in assays to test for specificity of this RNF38 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF38 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF38 (Ring Finger Protein 38 (RNF38))
- Andere Bezeichnung
- RNF38 (RNF38 Produkte)
- Synonyme
- 1700065B19Rik antikoerper, 2610202O07Rik antikoerper, AA673263 antikoerper, Oip1 antikoerper, ring finger protein 38 L homeolog antikoerper, ring finger protein 38 antikoerper, rnf38.L antikoerper, RNF38 antikoerper, Rnf38 antikoerper
- Hintergrund
- RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.
- Molekulargewicht
- 51 kDa (MW of target protein)
-