RNF38 Antikörper (N-Term)

Produktnummer ABIN629634

Produktdetails anti-RNF38 Antikörper

Target: RNF38 (Ring Finger Protein 38 (RNF38))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF38 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF38 antibody was raised against the N terminal of RNF38

Aufreinigung: Purified

Immunogen: RNF38 antibody was raised using the N terminal of RNF38 corresponding to a region with amino acids FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF38 Blocking Peptide, catalog no. 33R-2874, is also available for use as a blocking control in assays to test for specificity of this RNF38 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF38 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF38

Target: RNF38 (Ring Finger Protein 38 (RNF38))

Andere Bezeichnung: RNF38 (RNF38 Produkte)

Synonyme: 1700065B19Rik antikoerper, 2610202O07Rik antikoerper, AA673263 antikoerper, Oip1 antikoerper, ring finger protein 38 L homeolog antikoerper, ring finger protein 38 antikoerper, rnf38.L antikoerper, RNF38 antikoerper, Rnf38 antikoerper

Hintergrund: RNF38 is a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis.

Molekulargewicht: 51 kDa (MW of target protein)