Pyrophosphatase (Inorganic) 1 (PPA1) Antikörper

Produktnummer ABIN629633

Produktdetails

Target: Pyrophosphatase (Inorganic) 1 (PPA1)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Purified

Immunogen: PPA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPA1 Blocking Peptide, catalog no. 33R-7346, is also available for use as a blocking control in assays to test for specificity of this PPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Pyrophosphatase (Inorganic) 1 (PPA1)

Andere Bezeichnung: PPA1 (PPA1 Produkte)

Synonyme: ppa antikoerper, SCE9.16 antikoerper, PSPTO0722 antikoerper, AO090005001437 antikoerper, IOPPP antikoerper, PP antikoerper, PP1 antikoerper, SID6-8061 antikoerper, 2010317E03Rik antikoerper, Pyp antikoerper, Pp antikoerper, inorganic pyrophosphatase antikoerper, Inorganic pyrophosphatase antikoerper, pyrophosphatase (inorganic) 1 L homeolog antikoerper, pyrophosphatase (inorganic) 1 antikoerper, ppa antikoerper, SCO3409 antikoerper, ppa-1 antikoerper, APE_1692.1 antikoerper, AOR_1_2492174 antikoerper, Celal_2154 antikoerper, Celly_1958 antikoerper, Dester_1338 antikoerper, Marky_0054 antikoerper, Halhy_5834 antikoerper, ppa1.L antikoerper, PPA1 antikoerper, Ppa1 antikoerper

Substanzklasse: Viral Protein

Hintergrund: PPA1 is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.

Molekulargewicht: 33 kDa (MW of target protein)