EIF2S3 Antikörper (N-Term)
-
- Target Alle EIF2S3 Antikörper anzeigen
- EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte, Maus, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EIF2S3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EIF2 S3 antibody was raised against the N terminal of EIF2 3
- Aufreinigung
- Purified
- Immunogen
- EIF2 S3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI
- Top Product
- Discover our top product EIF2S3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EIF2S3 Blocking Peptide, catalog no. 33R-4841, is also available for use as a blocking control in assays to test for specificity of this EIF2S3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))
- Andere Bezeichnung
- EIF2S3 (EIF2S3 Produkte)
- Synonyme
- EIF2 antikoerper, EIF2G antikoerper, EIF2gamma antikoerper, eIF-2gA antikoerper, Su(var)3-9 antikoerper, fi03g03 antikoerper, wu:fi03g03 antikoerper, wu:fi37d04 antikoerper, zgc:63805 antikoerper, EIF2S3 antikoerper, eif2 antikoerper, eif2g antikoerper, eif2s3y antikoerper, eif2gamma antikoerper, Eif2g antikoerper, Eif2s3 antikoerper, PP42 antikoerper, ENSMUSG00000079297 antikoerper, eukaryotic translation initiation factor 2 subunit gamma antikoerper, eukaryotic translation initiation factor 2, subunit 3 gamma antikoerper, eukaryotic translation initiation factor 2 subunit gamma S homeolog antikoerper, putative eukaryotic translation initiation factor 2 subunit 3-like protein antikoerper, eukaryotic translation initiation factor 2 subunit 3 antikoerper, predicted pseudogene 2223 antikoerper, EIF2S3 antikoerper, eif2s3 antikoerper, eif2s3.S antikoerper, LOC738402 antikoerper, LOC100179499 antikoerper, LOC100624149 antikoerper, Eif2s3 antikoerper, Gm2223 antikoerper
- Hintergrund
- EIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
- Molekulargewicht
- 51 kDa (MW of target protein)
-