NR1I3 Antikörper (N-Term)

Produktnummer ABIN629575

Produktdetails anti-NR1I3 Antikörper

Target: NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR1I3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: NR1 I3 antibody was raised against the N terminal of NR1 3

Aufreinigung: Purified

Immunogen: NR1 I3 antibody was raised using the N terminal of NR1 3 corresponding to a region with amino acids MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFA

Anwendungsinformationen

Applikationshinweise: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR1I3 Blocking Peptide, catalog no. 33R-5759, is also available for use as a blocking control in assays to test for specificity of this NR1I3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR1I3

Target: NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))

Andere Bezeichnung: NR1I3 (NR1I3 Produkte)

Synonyme: AA209988 antikoerper, AI551208 antikoerper, CAR antikoerper, CAR-beta antikoerper, Care2 antikoerper, ESTM32 antikoerper, MB67 antikoerper, CAR1 antikoerper, CXR antikoerper, nuclear receptor subfamily 1 group I member 3 antikoerper, nuclear receptor subfamily 1, group I, member 3 antikoerper, NR1I3 antikoerper, Nr1i3 antikoerper

Hintergrund: NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway