PKIB Antikörper (Protein Kinase (CAMP-Dependent, Catalytic) Inhibitor beta)

Details for Product anti-PKIB Antibody No. ABIN5774655
Antigen
Reaktivität
Human
17
9
8
2
2
2
2
1
1
1
Wirt
Kaninchen
16
1
Klonalität
Polyklonal
Konjugat
Dieser PKIB Antikörper ist unkonjugiert
1
1
1
Applikation
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
13
8
5
4
2
2
1
Optionen
Verwendungszweck Rabbit polyclonal antibody raised against partial recombinant human PKIB.
Immunogen

immunogen: Recombinant protein corresponding to human PKIB.

Immunogen Sequence: MHILFVDVAMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDA

Isotyp IgG
Kreuzreaktivität Human
Antigen
Andere Bezeichnung PKIB (PKIB Antibody Abstract)
Hintergrund Full Gene Name: protein kinase (cAMP-dependent, catalytic) inhibitor beta
Synonyms: FLJ23817,PRKACN2
Gen-ID 5570
UniProt Q9C010
Pathways Myometrial Relaxation and Contraction
Applikations-hinweise Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).
Konservierungs-mittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Protein Kinase (CAMP-Dependent, Catalytic) Inhibitor beta (PKIB) antibody (ABIN5774655) Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kid...