FZD3 Antikörper
-
- Target Alle FZD3 Antikörper anzeigen
- FZD3 (Frizzled Family Receptor 3 (FZD3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FZD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL from the human protein were used as the immunogen for the FZD3 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product FZD3 Primärantikörper
-
-
- Applikationshinweise
- Optimal dilution of the FZD3 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the FZD3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- FZD3 (Frizzled Family Receptor 3 (FZD3))
- Andere Bezeichnung
- FZD3 / Frizzled 3 (FZD3 Produkte)
- Synonyme
- Fz-3 antikoerper, FZ-3 antikoerper, fz3 antikoerper, Xfz3 antikoerper, frz3 antikoerper, hfz3 antikoerper, frz-3 antikoerper, frizzled3 antikoerper, frizzled-3 antikoerper, FZD3 antikoerper, AU020229 antikoerper, D930050A07Rik antikoerper, Fz3 antikoerper, fz9 antikoerper, fzd3 antikoerper, zg09 antikoerper, fzd3l antikoerper, frizzled class receptor 3 antikoerper, frizzled class receptor 3 L homeolog antikoerper, frizzled class receptor 3a antikoerper, frizzled class receptor 3b antikoerper, FZD3 antikoerper, fzd3 antikoerper, fzd3.L antikoerper, Fzd3 antikoerper, fzd3a antikoerper, fzd3b antikoerper
- Hintergrund
- Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.
- UniProt
- Q9NPG1
- Pathways
- WNT Signalweg, Tube Formation
-