14-3-3 zeta Antikörper

Produktnummer ABIN5708416

Produktdetails anti-14-3-3 zeta Antikörper

Target: 14-3-3 zeta (YWHAZ)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser 14-3-3 zeta Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ were used as the immunogen for the 14-3-3 zeta antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the 14-3-3 zeta antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the 14-3-3 zeta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu 14-3-3 zeta

Target: 14-3-3 zeta (YWHAZ)

Andere Bezeichnung: 14-3-3 zeta / YWHAZ (YWHAZ Produkte)

Synonyme: 14-3-3-zeta antikoerper, KCIP-1 antikoerper, YWHAD antikoerper, 14-3-3zeta antikoerper, Ywhaz antikoerper, ACYPI003154 antikoerper, 14-3-3z antikoerper, kcip-1 antikoerper, ywhaq antikoerper, 1433z antikoerper, ywhaz antikoerper, ywhazb antikoerper, 1110013I11Rik antikoerper, AI596267 antikoerper, AL022924 antikoerper, AU020854 antikoerper, ywhaza antikoerper, fb14h09 antikoerper, wu:fb05g08 antikoerper, wu:fb14h09 antikoerper, ywhai antikoerper, zgc:55807 antikoerper, 14-3-3 antikoerper, 14-3-3 zeta antikoerper, 14-3-3ZETA antikoerper, 14-3-3leo antikoerper, 2G1 antikoerper, 4-3-3 zeta antikoerper, 5.11 antikoerper, 549 antikoerper, BEST:GH05075 antikoerper, CG17870 antikoerper, D14-3-3 antikoerper, D14-3-3zeta antikoerper, Dmel\\CG17870 antikoerper, K antikoerper, LEO antikoerper, Leo antikoerper, PAR-5 antikoerper, PAR5 antikoerper, Par-5 antikoerper, d14-3-3zeta antikoerper, l(2)07103 antikoerper, l(2)46CFe antikoerper, l(2)46Ee antikoerper, leo antikoerper, par-5 antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antikoerper, 14-3-3 protein zeta antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antikoerper, 14-3-3 protein zeta/delta pseudogene antikoerper, CG17870 gene product from transcript CG17870-RE antikoerper, YWHAZ antikoerper, 14-3-3zeta antikoerper, ywhaz antikoerper, 1433z antikoerper, ywhaz.L antikoerper, Ywhaz antikoerper, ywhaz.S antikoerper, LOC100855903 antikoerper

Hintergrund: 14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

UniProt: P63104

Pathways: Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location