SP6 Antikörper

Produktnummer ABIN5708284

Produktdetails anti-SP6 Antikörper

Target: SP6 (Sp6 Transcription Factor (SP6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH from the human protein were used as the immunogen for the SP6 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SP6 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the SP6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SP6

Target: SP6 (Sp6 Transcription Factor (SP6))

Andere Bezeichnung: SP6 / Transcription factor Sp6 (SP6 Produkte)

Synonyme: xsp6 antikoerper, MGC131081 antikoerper, EPFN antikoerper, EPIPROFIN antikoerper, KLF14 antikoerper, 1110025J03Rik antikoerper, AA591031 antikoerper, AI592962 antikoerper, Epfn antikoerper, Klf14 antikoerper, Sp6 transcription factor antikoerper, Sp5 transcription factor L homeolog antikoerper, trans-acting transcription factor 6 antikoerper, SP6 antikoerper, sp5.L antikoerper, Sp6 antikoerper

Hintergrund: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.

UniProt: Q3SY56