CRTC2 Antikörper

Produktnummer ABIN5708213

Produktdetails anti-CRTC2 Antikörper

Target: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CRTC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR were used as the immunogen for the TORC2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the TORC2 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the TORC2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu CRTC2

Target: CRTC2 (CREB Regulated Transcription Coactivator 2 (CRTC2))

Andere Bezeichnung: TORC2 / CRTC2 (CRTC2 Produkte)

Synonyme: CRTC2 antikoerper, TORC-2 antikoerper, TORC2 antikoerper, 4632407F12Rik antikoerper, Torc2 antikoerper, mTORC2 antikoerper, RGD1308903 antikoerper, CREB regulated transcription coactivator 2 antikoerper, CRTC2 antikoerper, Crtc2 antikoerper

Hintergrund: TORC2 (Transducer of CREB protein 2), also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.

UniProt: Q53ET0

Pathways: AMPK Signaling, Carbohydrate Homeostasis